PDB entry 1u15

View 1u15 on RCSB PDB site
Description: crystal structure of a duck-delta-crystallin-1 double loop mutant (dlm)
Deposited on 2004-07-14, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u15a_
  • Chain 'B':
    Domains in SCOP 1.71: d1u15b_
  • Chain 'C':
    Domains in SCOP 1.71: d1u15c_
  • Chain 'D':
    Domains in SCOP 1.71: d1u15d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u15A (A:)
    masegdklmggrfvgstdpimeklnssiaydqrlsevdiqasiayakalekagiltktel
    ekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtd
    lklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshaval
    trdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdfvv
    eflsvatlllihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirska
    grvfgrlasilmvlkglpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenm
    ekaltpemlatdlalylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplf
    ssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u15A (A:)
    tdpimeklnssiaydqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqkeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u15B (B:)
    masegdklmggrfvgstdpimeklnssiaydqrlsevdiqasiayakalekagiltktel
    ekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtd
    lklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshaval
    trdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdfvv
    eflsvatlllihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirska
    grvfgrlasilmvlkglpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenm
    ekaltpemlatdlalylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplf
    ssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u15B (B:)
    tdpimeklnssiaydqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqkeqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u15C (C:)
    masegdklmggrfvgstdpimeklnssiaydqrlsevdiqasiayakalekagiltktel
    ekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtd
    lklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshaval
    trdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdfvv
    eflsvatlllihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirska
    grvfgrlasilmvlkglpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenm
    ekaltpemlatdlalylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplf
    ssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u15C (C:)
    tdpimeklnssiaydqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u15D (D:)
    masegdklmggrfvgstdpimeklnssiaydqrlsevdiqasiayakalekagiltktel
    ekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtd
    lklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshaval
    trdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdfvv
    eflsvatlllihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirska
    grvfgrlasilmvlkglpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenm
    ekaltpemlatdlalylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplf
    ssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u15D (D:)
    tdpimeklnssiaydqrlsevdiqasiayakalekagiltktelekilsglekiseewsk
    gvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisthl
    lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
    lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlskm
    aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
    lpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
    lvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsveq
    ytalggtakssvttqieqlrelmkkqkeqa