PDB entry 1u14

View 1u14 on RCSB PDB site
Description: The crystal structure of hypothetical UPF0244 protein yjjX at resolution 1.68 Angstrom
Class: structural genomics
Keywords: structural genomics, protein structure initiative, PSI, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-07-14, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.184
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0244 protein yjjX
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yjjX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39432 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (124)
    Domains in SCOPe 2.08: d1u14a1, d1u14a2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u14A (A:)
    amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv
    dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea
    lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhnavyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u14A (A:)
    amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv
    dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea
    lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna