PDB entry 1u13

View 1u13 on RCSB PDB site
Description: Crystal structure analysis of the C37L/C151T/C442A-triple mutant of CYP51 from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: alpha-beta, heme co-factor, OXIDOREDUCTASE
Deposited on 2004-07-14, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 51
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Name=cyp51; OrderedLocusNames=Rv0764c, MT0788, Mb0787c; ORFNames=MTCY369.09c;
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A512
      • engineered (36)
      • engineered (150)
      • engineered (441)
    Domains in SCOPe 2.07: d1u13a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u13A (A:)
    msavalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshane
    fffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedq
    vrrmiadwgeageidlldffaeltiytssatligkkfrdqldgrfaklyhelergtdpla
    yvdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtpr
    fsadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfha
    lrqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfp
    dphdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefema
    qppesyrndhskmvvqlaqpaavryrrrtgvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u13A (A:)
    savalprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanef
    ffragdddldqakaypfmtpifgrrkemlhnaalrgeqmkghaatiedqvrrmiadwgea
    geidlldffaeltiytssatligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
    rrrdearnglvalvadimngrianpdrdmldvliavkaetgtprfsadeitgmfismmfa
    ghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketlr
    lhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprqe
    dllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvvq
    laqpaavryrrrt