PDB entry 1u12

View 1u12 on RCSB PDB site
Description: M. loti cyclic nucleotide binding domain mutant
Class: membrane protein
Keywords: mutant cyclic nucleotide binding domain, C-helix mutation, unliganded, MEMBRANE PROTEIN
Deposited on 2004-07-14, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.253
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclic nucleotide binding domain
    Species: Mesorhizobium loti [TaxId:266835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (130)
    Domains in SCOPe 2.08: d1u12a_
  • Chain 'B':
    Compound: cyclic nucleotide binding domain
    Species: Mesorhizobium loti [TaxId:266835]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u12b_
  • Heterogens: IOD, SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u12A (A:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktaleargaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u12A (A:)
    rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
    svsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeia
    eifrktalear
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u12B (B:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktaleargaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u12B (B:)
    gdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvvegsv
    svatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspeiaei
    frktale