PDB entry 1u11

View 1u11 on RCSB PDB site
Description: PurE (N5-carboxyaminoimidazole Ribonucleotide Mutase) from the acidophile Acetobacter aceti
Deposited on 2004-07-14, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.189
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u11a_
  • Chain 'B':
    Domains in SCOP 1.69: d1u11b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u11A (A:)
    msetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsahr
    tpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdslls
    ivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspite
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u11A (A:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u11B (B:)
    msetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsahr
    tpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdslls
    ivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspite
    dk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u11B (B:)
    aasapvvgiimgsqsdwetmrhadallteleiphetlivsahrtpdrladyartaaergl
    nviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaiga
    sgaknaallaasilalynpalaarletwralqtasvpnspite