PDB entry 1u10

View 1u10 on RCSB PDB site
Description: MEPA, active form with ZN in P1
Deposited on 2004-07-14, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u10a_
  • Chain 'B':
    Domains in SCOP 1.69: d1u10b_
  • Chain 'C':
    Domains in SCOP 1.69: d1u10c_
  • Chain 'D':
    Domains in SCOP 1.69: d1u10d_
  • Chain 'E':
    Domains in SCOP 1.69: d1u10e_
  • Chain 'F':
    Domains in SCOP 1.69: d1u10f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u10A (A:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10A (A:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrghashqtgldvdiflqlpktrwtsaqllrpqald
    lvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrkvrp
    wfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfelppscqalld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u10B (B:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10B (B:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfelppscqalldehvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u10C (C:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10C (C:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u10D (D:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10D (D:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
    i
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u10E (E:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10E (E:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u10F (F:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10F (F:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeplppscqalldehvi