PDB entry 1u10

View 1u10 on RCSB PDB site
Description: MEPA, active form with ZN in P1
Class: hydrolase
Keywords: LAS enzyme, metallopeptidase, peptidoglycan hydrolase
Deposited on 2004-07-14, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14007 (0-End)
      • modified residue (41)
      • modified residue (56)
      • modified residue (70)
      • modified residue (78)
      • modified residue (80)
      • modified residue (190)
    Domains in SCOPe 2.07: d1u10a_
  • Chain 'B':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14007 (0-254)
      • modified residue (41)
      • modified residue (56)
      • modified residue (70)
      • modified residue (78)
      • modified residue (80)
      • modified residue (190)
    Domains in SCOPe 2.07: d1u10b_
  • Chain 'C':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14007 (0-254)
      • modified residue (41)
      • modified residue (56)
      • modified residue (70)
      • modified residue (78)
      • modified residue (80)
      • modified residue (190)
    Domains in SCOPe 2.07: d1u10c_
  • Chain 'D':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14007 (0-254)
      • modified residue (41)
      • modified residue (56)
      • modified residue (70)
      • modified residue (78)
      • modified residue (80)
      • modified residue (190)
    Domains in SCOPe 2.07: d1u10d_
  • Chain 'E':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14007 (0-254)
      • modified residue (41)
      • modified residue (56)
      • modified residue (70)
      • modified residue (78)
      • modified residue (80)
      • modified residue (190)
    Domains in SCOPe 2.07: d1u10e_
  • Chain 'F':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14007 (0-254)
      • modified residue (41)
      • modified residue (56)
      • modified residue (70)
      • modified residue (78)
      • modified residue (80)
      • modified residue (190)
    Domains in SCOPe 2.07: d1u10f_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u10A (A:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10A (A:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrghashqtgldvdiflqlpktrwtsaqllrpqald
    lvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrkvrp
    wfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfelppscqalld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u10B (B:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10B (B:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfelppscqalldehvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u10C (C:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10C (C:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u10D (D:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10D (D:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
    i
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u10E (E:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10E (E:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldehv
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u10F (F:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u10F (F:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeplppscqalldehvi