PDB entry 1u0y

View 1u0y on RCSB PDB site
Description: N-Domain Of Grp94, with the Charged Domain, In Complex With the Novel Ligand N-Propyl Carboxyamido Adenosine
Class: chaperone
Keywords: GRP94, Hsp90, Bergerat, Chaperone, Endoplasmic reticulum, NECA, Adenosine, NPCA
Deposited on 2004-07-14, released 2005-07-05
Made obsolete by 6d1x on 2018-05-02

The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis familiaris
    Gene: TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u0ya1
  • Heterogens: PA7, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0yA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeeke
    dsddeaaveeeeeekkpktkkvektvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0yA (A:)
    sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
    tvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseli
    gqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlk
    eeasdyleldtiknlvkkysqfinfpiyvwssktektvwdwelmn