PDB entry 1u0y

View 1u0y on RCSB PDB site
Description: n-domain of grp94, with the charged domain, in complex with the novel ligand n-propyl carboxyamido adenosine
Deposited on 2004-07-14, released 2005-07-05
Made obsolete by 6d1x on 2018-05-02

The last revision was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PA7, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1u0yA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeeke
    dsddeaaveeeeeekkpktkkvektvwdwelmn
    

    Sequence, based on observed residues (ATOM records):
    >1u0yA (A:)
    sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
    tvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseli
    gqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlk
    eeasdyleldtiknlvkkysqfinfpiyvwssktektvwdwelmn