PDB entry 1u0s

View 1u0s on RCSB PDB site
Description: Chemotaxis kinase CheA P2 domain in complex with response regulator CheY from the thermophile thermotoga maritima
Class: signaling protein
Keywords: protein-protein complex, alpha/beta sandwich, signaling complex, transient interaction, transient complex of thermostable proteins, SIGNALING PROTEIN
Deposited on 2004-07-14, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chemotaxis protein chea
  Species: Thermotoga maritima [TaxId:2336]
  Gene: CHEA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56310 (0-85)
  Domains in SCOPe 2.07: d1u0sa_
• Chain 'Y':
  Compound: Chemotaxis protein cheY
  Species: Thermotoga maritima [TaxId:2336]
  Gene: cheY
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q56312 (0-117)
  Domains in SCOPe 2.07: d1u0sy_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u0sA (A:)
  gfktfyikvilkegtqlksariylvfhkleelkcevvrtipsveeieeekfenevelfvi
  spvdleklsealssiadierviikev
  

  
  
• Chain 'Y':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u0sY (Y:)
  gkrvlivddaafmrmmlkdiitkagyevageatngreavekykelkpdivtmditmpemn
  gidaikeimkidpnakiivcsamgqqamvieaikagakdfivkpfqpsrvvealnkvs