PDB entry 1u0r

View 1u0r on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis NAD kinase
Class: signaling protein, transferase
Keywords: alpha-beta; beta sandwich, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2004-07-14, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0ra_
  • Chain 'B':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0rb_
  • Chain 'C':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0rc_
  • Chain 'D':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u0rd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0rA (A:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vtgwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0rA (A:)
    hrsvllvvhtatetarrvekvlgdnkialrvlsaeaveievvdadqhaadgcelvlvlgg
    dgtflraaelarnasipvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedrltldvv
    vrqggrivnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgvlvstptgstayaf
    saggpvlwpdleailvvpnnahalfgrpmvtspeatiaieieadghdalvfcdgrremli
    pagsrlevtrcvtsvkwarldsapftdrlvrkfrlpvtgwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0rB (B:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vtgwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0rB (B:)
    vllvvhatetarrvekvlgdndqhaadgcelvlvlggdgtflraaelarnasipvlgvnl
    grigflaeaeaeaidavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgp
    rlgvlgvvveidgrpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnaha
    lfgrpmvtspeatiaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsa
    pftdrlvrkfrlpvtgwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u0rC (C:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vtgwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0rC (C:)
    ahrsvllvvhtrdeatetarrvekvlgdnkialrvlsaeavdrevvdadqhaadgcelvl
    vlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedrlt
    ldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgvlvstptgst
    ayafsaggpvlwpdleailvvpnnahalfgrpmvtspeatiaieieadghdalvfcdgrr
    emlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlpvtgwr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u0rD (D:)
    mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramg
    veievvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaea
    idavlehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidg
    rpvsafgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeat
    iaieieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlp
    vtgwrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0rD (D:)
    tahrsvllvvhtgatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramgveie
    vvdadqhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidav
    lehvvaqdyrvedrltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvs
    afgcdgvlvstptgstayafsaggpvlwpdleailvvpnnahalfgrpmvtspeatiaie
    ieadghdalvfcdgrremlipagsrlevtrcvtsvkwarldsapftdrlvrkfrlpvtgw
    r