PDB entry 1u0q

View 1u0q on RCSB PDB site
Description: Structure of a Llama VHH domain raised against a carbazole molecule
Class: immune system
Keywords: immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2004-07-14, released 2005-06-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin heavy chain variable domain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U0Q
    Domains in SCOPe 2.01: d1u0qa_
  • Chain 'B':
    Compound: immunoglobulin heavy chain variable domain
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 1U0Q (0-124)
    Domains in SCOPe 2.01: d1u0qb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0qA (A:)
    evqlqesggglvqaggslrlscaasgrtfstyavgwfrqapgkerefvgyfgtrggrtyy
    adsvkgrftiaidnakntvylqmnslklddtavyycavrmpysgdyrssgtydywgqgtq
    vtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0qB (B:)
    evqlqesggglvqaggslrlscaasgrtfstyavgwfrqapgkerefvgyfgtrggrtyy
    adsvkgrftiaidnakntvylqmnslklddtavyycavrmpysgdyrssgtydywgqgtq
    vtvss