PDB entry 1u0n

View 1u0n on RCSB PDB site
Description: The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
Class: blood clotting
Keywords: Rossmann fold, LRR motif, C-type lectin fold, Protein-Protein complex, BLOOD CLOTTING
Deposited on 2004-07-13, released 2005-04-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.213
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF,F8VWF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1u0na_
  • Chain 'B':
    Compound: Botrocetin
    Species: Bothrops jararaca [TaxId:8724]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1u0nb_
  • Chain 'C':
    Compound: Botrocetin
    Species: Bothrops jararaca [TaxId:8724]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1u0nc_
  • Chain 'D':
    Compound: Platelet glycoprotein Ib
    Species: Homo sapiens [TaxId:9606]
    Gene: GP1BA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359 (0-264)
      • engineered (20)
      • engineered (158)
    Domains in SCOPe 2.01: d1u0nd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0nA (A:)
    disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
    yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
    alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
    ssvdeleqqrdeivsylcdlapeapppt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0nB (B:)
    dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
    qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
    aqknpfvcksppp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0nC (C:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
    cefqa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0nD (D:)
    hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
    nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
    rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
    enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
    snvasvqcdnsdkfpvykypgkgcp