PDB entry 1u0m

View 1u0m on RCSB PDB site
Description: Crystal Structure of 1,3,6,8-Tetrahydroxynaphthalene Synthase (THNS) from Streptomyces coelicolor A3(2): a Bacterial Type III Polyketide Synthase (PKS) Provides Insights into Enzymatic Control of Reactive Polyketide Intermediates
Deposited on 2004-07-13, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.253
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0mA (A:)
    gshggsgfmatlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhi
    vqpiedtlehpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmp
    sltawlinemgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcy
    qptdlgvgsllcnglfgdgiaaavvrgrggtgvrlerngsylipktedwimydvkatgfh
    flldkrvpatmeplapalkelagehgwdasdldfyivhaggprilddlstflevdphafr
    fsratlteygniasavvldalrrlfdeggveegargllagfgpgitaemslgcwqtadvr
    rgirqdvtrtaargvsrrvrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0mA (A:)
    atlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhivqpiedtle
    hpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmpsltawline
    mgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcyqptdlgvgs
    llcnglfgdgiaaavvrgrggtgvrlerngsylipktedwimydvkatgfhflldkrvpa
    tmeplapalkelagehgwdasdldfyivhaggprilddlstflevdphafrfsratltey
    gniasavvldalrrlfdeggveegargllagfgpgitaemslgcwqta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0mB (B:)
    gshggsgfmatlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhi
    vqpiedtlehpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmp
    sltawlinemgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcy
    qptdlgvgsllcnglfgdgiaaavvrgrggtgvrlerngsylipktedwimydvkatgfh
    flldkrvpatmeplapalkelagehgwdasdldfyivhaggprilddlstflevdphafr
    fsratlteygniasavvldalrrlfdeggveegargllagfgpgitaemslgcwqtadvr
    rgirqdvtrtaargvsrrvrqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0mB (B:)
    atlcrpsvsvpehvitmeetlelarrrhtdhpqlplalrlientgvrtrhivqpiedtle
    hpgfedrnkvyereaksrvpaviqralddaellatdidviiyvsctgfmmpsltawline
    mgfdsttrqipiaqlgcaaggaainrahdfctaypeanalivacefcslcyqptdlgvgs
    llcnglfgdgiaaavvrgrggtgvrlerngsylipktedwimydvkatgfhflldkrvpa
    tmeplapalkelagehgwdasdldfyivhaggprilddlstflevdphafrfsratltey
    gniasavvldalrrlfdeggveegargllagfgpgitaemslgcwqta