PDB entry 1u0l

View 1u0l on RCSB PDB site
Description: Crystal structure of YjeQ from Thermotoga maritima
Class: hydrolase
Keywords: GTPase, permutation, OB-fold, Zinc-finger, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2004-07-13, released 2004-09-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTPase engC
    Species: Thermotoga maritima [TaxId:2336]
    Gene: engC, YJEQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1u0la1, d1u0la2
  • Chain 'B':
    Compound: Probable GTPase engC
    Species: Thermotoga maritima [TaxId:2336]
    Gene: engC, YJEQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1u0lb1, d1u0lb2
  • Chain 'C':
    Compound: Probable GTPase engC
    Species: Thermotoga maritima [TaxId:2336]
    Gene: engC, YJEQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1u0lc1, d1u0lc2
  • Heterogens: ZN, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0lA (A:)
    ggggggmnlrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpd
    etgsgvienvlhrknlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvm
    vinkmdlydeddlrkvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgv
    gkssllnainpglklrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindie
    peelkhyfkefgdkqcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrrk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0lA (A:)
    lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie
    nvlhrknlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdly
    deddlrkvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllna
    inpglklrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdc
    nhvdepecgvkeavengeiaesryenyvkmfyellgrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0lB (B:)
    ggggggmnlrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpd
    etgsgvienvlhrknlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvm
    vinkmdlydeddlrkvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgv
    gkssllnainpglklrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindie
    peelkhyfkefgdkqcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrrk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0lB (B:)
    lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie
    nvlhrknlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdly
    deddlrkvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllna
    inpglklrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdc
    nhvdepecgvkeavengeiaesryenyvkmfyellgrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u0lC (C:)
    ggggggmnlrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpd
    etgsgvienvlhrknlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvm
    vinkmdlydeddlrkvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgv
    gkssllnainpglklrvsevseklqrgrhttttaqllkfdfggyvvdtpgfanleindie
    peelkhyfkefgdkqcffsdcnhvdepecgvkeavengeiaesryenyvkmfyellgrrk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0lC (C:)
    lrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvie
    nvlhrknlltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdly
    deddlrkvreleeiysglypivktsaktgmgieelkeylkgkistmaglsgvgkssllna
    inpglklrttttaqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdc
    nhvdepecgvkeavengeiaesryenyvkmfyellgrr