PDB entry 1u0k

View 1u0k on RCSB PDB site
Description: the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa
Deposited on 2004-07-13, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0kA (A:)
    ghmsrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddpra
    frariftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfya
    emdqgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrar
    qvndlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaar
    gepfvlhqgrflerpsrldvqvatdgsvrvgghvqllaraelltsags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0kA (A:)
    msrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafr
    ariftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaem
    dqgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrarqv
    ndlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaarge
    pfvlhqgrflerpsrldvqvatdgsvrvgghvqllaraelltsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0kB (B:)
    ghmsrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddpra
    frariftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfya
    emdqgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrar
    qvndlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaar
    gepfvlhqgrflerpsrldvqvatdgsvrvgghvqllaraelltsags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0kB (B:)
    srrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafra
    riftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaemd
    qgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrarqvn
    dlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaargep
    fvlhqgrflerpsrldvqvatdgsvrvgghvqllaraellts