PDB entry 1u0k

View 1u0k on RCSB PDB site
Description: The structure of a Predicted Epimerase PA4716 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: sctructural genomics, MCSG, Pseudomonas aeruginosa, protein structure initiative, Structural Genomics, PSI, Midwest Center for Structural Genomics, unknown function
Deposited on 2004-07-13, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene product PA4716
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HV82 (2-285)
      • modified residue (2)
      • modified residue (36)
      • modified residue (121)
    Domains in SCOPe 2.07: d1u0ka1, d1u0ka2
  • Chain 'B':
    Compound: gene product PA4716
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4716
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HV82
      • modified residue (36)
      • modified residue (121)
    Domains in SCOPe 2.07: d1u0kb1, d1u0kb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0kA (A:)
    ghmsrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddpra
    frariftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfya
    emdqgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrar
    qvndlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaar
    gepfvlhqgrflerpsrldvqvatdgsvrvgghvqllaraelltsags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0kA (A:)
    msrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafr
    ariftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaem
    dqgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrarqv
    ndlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaarge
    pfvlhqgrflerpsrldvqvatdgsvrvgghvqllaraelltsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0kB (B:)
    ghmsrrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddpra
    frariftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfya
    emdqgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrar
    qvndlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaar
    gepfvlhqgrflerpsrldvqvatdgsvrvgghvqllaraelltsags
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0kB (B:)
    srrywqldvfaerpltgnglavfddasalddaamqawtrelrqfesifllpgddprafra
    riftleeelpfaghpllgaaallhhlrggdneqhwtlhlasksvalrsvragsgfyaemd
    qgraefgatpdagtcrwfaeafslsandlsghpprvvstglpylllpvtaealgrarqvn
    dlqealdklgaafvylldvdgregrtwdnlglvedvatgsaagpvaaylveyglaargep
    fvlhqgrflerpsrldvqvatdgsvrvgghvqllaraellts