PDB entry 1u0j

View 1u0j on RCSB PDB site
Description: Crystal Structure of AAV2 Rep40-ADP complex
Class: replication
Keywords: AAA+ protein, P-loop ATPases, Helicase, REPLICATION
Deposited on 2004-07-13, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA replication protein
    Species: Adeno-associated virus - 2 [TaxId:10804]
    Gene: rep
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03132 (1-266)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1u0ja1, d1u0ja2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0jA (A:)
    gmelvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdy
    lvgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktni
    aeaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvdq
    kckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtk
    qevkdffrwakdhvvevehefyvkkgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0jA (A:)
    gmelvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdy
    lvgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktni
    aeaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvsa
    qidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtkqevkdf
    frwakdhvvevehefyvkkgg