PDB entry 1u0e

View 1u0e on RCSB PDB site
Description: Crystal structure of mouse phosphoglucose isomerase
Class: isomerase
Keywords: aldose-ketose isomerase, dimer, ISOMERASE
Deposited on 2004-07-13, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.213
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Mus musculus [TaxId:10090]
    Gene: GPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06745
      • see remark 999 (263)
    Domains in SCOPe 2.07: d1u0ea1, d1u0ea2
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Mus musculus [TaxId:10090]
    Gene: GPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06745
      • see remark 999 (263)
    Domains in SCOPe 2.07: d1u0eb1, d1u0eb2
  • Heterogens: SO4, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0eA (A:)
    maaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlv
    nkevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmp
    evnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggpr
    vwfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsava
    khfvalstntakvkefgidpqnmlefwdwvggryslwsaiglsialhvgfdhfeqllsga
    hwmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesn
    gkyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivft
    kltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshds
    stnglisfikqqrdtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0eA (A:)
    aaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlvn
    kevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmpe
    vnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggprv
    wfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsavak
    hfvalstntakvkefgidpqnmlefwdwvggryslwsaiglsialhvgfdhfeqllsgah
    wmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesng
    kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
    hkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivftk
    ltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshdss
    tnglisfikqqrdtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0eB (B:)
    maaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlv
    nkevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmp
    evnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggpr
    vwfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsava
    khfvalstntakvkefgidpqnmlefwdwvggryslwsaiglsialhvgfdhfeqllsga
    hwmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesn
    gkyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivft
    kltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshds
    stnglisfikqqrdtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0eB (B:)
    aaltrnpqfqkllewhransanlklrelfeadperfnnfslnlntnhghilvdysknlvn
    kevmqmlvelaksrgveaardnmfsgskinytedravlhvalrnrsntpikvdgkdvmpe
    vnrvldkmksfcqrvrsgdwkgytgksitdiinigiggsdlgplmvtealkpyskggprv
    wfvsnidgthiaktlaslspetslfiiasktfttqetitnaetakewfleaakdpsavak
    hfvalstntakvkefgidpqnmlefwdwvggryslwsaiglsialhvgfdhfeqllsgah
    wmdqhflktpleknapvllallgiwyincygcethallpydqymhrfaayfqqgdmesng
    kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
    hkillanflaqtealmkgklpeearkelqaagkspedlekllphkvfegnrptnsivftk
    ltpfilgaliamyehkifvqgimwdinsfdqwgvelgkqlakkiepelegssavtshdss
    tnglisfikqqrdtkl