PDB entry 1u0d

View 1u0d on RCSB PDB site
Description: Y33H Mutant of Homing endonuclease I-CreI
Class: HYDROLASE/dna
Keywords: DNA endonuclease I-CreI, PROTEIN/dna, HYDROLASE-dna COMPLEX
Deposited on 2004-07-13, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered mutation (32)
      • engineered mutation (41)
      • engineered mutation (46)
      • engineered mutation (109-110)
    Domains in SCOPe 2.07: d1u0da_
  • Chain 'B':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered mutation (32)
      • engineered mutation (41)
      • engineered mutation (46)
      • engineered mutation (109-110)
    Domains in SCOPe 2.07: d1u0db_
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*ap*ap*ap*cp*gp*tp*cp*gp*tp*gp*ap*gp*ap*cp*ap*gp*tp*tp*cp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*gp*gp*ap*ap*cp*tp*gp*tp*cp*tp*cp*ap*cp*gp*ap*cp*gp*tp*tp*tp*cp*gp*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0dA (A:)
    mntkynkefllylagfvdgdgsiiaqikpnqshkfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0dA (A:)
    ntkynkefllylagfvdgdgsiiaqikpnqshkfkhqlsltfqvtektqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0dB (B:)
    mntkynkefllylagfvdgdgsiiaqikpnqshkfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0dB (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqshkfkhqlsltfqvtektqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.