PDB entry 1u0c

View 1u0c on RCSB PDB site
Description: Y33C Mutant of Homing endonuclease I-CreI
Deposited on 2004-07-13, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1u0ca_
  • Chain 'B':
    Domains in SCOP 1.71: d1u0cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0cA (A:)
    mntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0cA (A:)
    ntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0cB (B:)
    mntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0cB (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld