PDB entry 1u0c

View 1u0c on RCSB PDB site
Description: Y33C Mutant of Homing endonuclease I-CreI
Class: hydrolase/DNA
Keywords: DNA endonuclease I-CreI, protein/DNA, hydrolase-DNA COMPLEX
Deposited on 2004-07-13, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered mutation (32)
      • engineered mutation (41)
      • engineered mutation (46)
      • engineered mutation (109-110)
    Domains in SCOPe 2.07: d1u0ca_
  • Chain 'B':
    Compound: DNA endonuclease I-crei
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725
      • engineered mutation (32)
      • engineered mutation (41)
      • engineered mutation (46)
      • engineered mutation (109-110)
    Domains in SCOPe 2.07: d1u0cb_
  • Chain 'C':
    Compound: 5'-d(*gp*cp*tp*ap*ap*ap*cp*gp*tp*cp*gp*tp*gp*ap*gp*ap*cp*ap*gp*tp*tp*ap*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*gp*tp*ap*ap*cp*tp*gp*tp*cp*tp*cp*ap*cp*gp*ap*cp*gp*tp*tp*tp*ap*gp*c)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u0cA (A:)
    mntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0cA (A:)
    ntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u0cB (B:)
    mntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u0cB (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqsckfkhqlsltfqvtektqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.