PDB entry 1u0a

View 1u0a on RCSB PDB site
Description: Crystal structure of the engineered beta-1,3-1,4-endoglucanase H(A16-M) in complex with beta-glucan tetrasaccharide
Class: hydrolase
Keywords: 1, 3-1, 4-beta-glucanase, protein-carbohydrate interaction, active-site variant, jellyroll architecture, hydrolase
Deposited on 2004-07-13, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.164
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucanase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23904
      • see remark 999 (0-15)
      • engineered (104)
      • engineered (108)
    Domains in SCOPe 2.07: d1u0aa_
  • Chain 'B':
    Compound: Beta-glucanase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23904
      • see remark 999 (0-15)
      • engineered (104)
      • engineered (108)
    Domains in SCOPe 2.07: d1u0ab_
  • Chain 'C':
    Compound: Beta-glucanase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23904
      • see remark 999 (0-15)
      • engineered (104)
      • engineered (108)
    Domains in SCOPe 2.07: d1u0ac_
  • Chain 'D':
    Compound: Beta-glucanase
    Species: Paenibacillus macerans [TaxId:44252]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23904 (16-213)
      • see remark 999 (0-15)
      • engineered (104)
      • engineered (108)
    Domains in SCOPe 2.07: d1u0ad_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0aA (A:)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdqidiqflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0aB (B:)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdqidiqflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0aC (C:)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdqidiqflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u0aD (D:)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdqidiqflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn