PDB entry 1u07

View 1u07 on RCSB PDB site
Description: Crystal Structure of the 92-residue C-term. part of TonB with significant structural changes compared to shorter fragments
Class: protein transport
Keywords: beta-hairpin, PROTEIN TRANSPORT
Deposited on 2004-07-13, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TonB protein
    Species: Escherichia coli [TaxId:562]
    Gene: tonB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u07a_
  • Chain 'B':
    Compound: TonB protein
    Species: Escherichia coli [TaxId:562]
    Gene: tonB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u07b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u07A (A:)
asgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevkna
mrrwryepgkpgsgivvnilfkingtteiq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1u07B (B:)
asgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevkna
mrrwryepgkpgsgivvnilfkingtteiq

    Sequence, based on observed residues (ATOM records): (download) 
    >1u07B (B:)
gpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevknamr
rwryepgkpgsgivvnilfkingtteiq