PDB entry 1u05

View 1u05 on RCSB PDB site
Description: Crystal structure of protein yfiH from Shigella flexneri, Pfam DUF152
Class: Structural Genomics, Unknown function
Keywords: Structural Genomics, Hypothetical protein, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Unknown function
Deposited on 2004-07-12, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf, conserved hypothetical protein
    Species: Shigella flexneri [TaxId:623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u05a_
  • Chain 'B':
    Compound: orf, conserved hypothetical protein
    Species: Shigella flexneri [TaxId:623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u05b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u05A (A:)
    msklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnl
    pskpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtev
    aavhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakas
    aafiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfi
    wli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u05B (B:)
    msklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnl
    pskpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtev
    aavhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakas
    aafiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfi
    wli