PDB entry 1u04

View 1u04 on RCSB PDB site
Description: Crystal structure of full length Argonaute from Pyrococcus furiosus
Class: hydrolase/gene regulation
Keywords: RNAi, Silencing, Argonaute, PIWI, PAZ, RISC, Slicer, RNase H, HYDROLASE-GENE REGULATION COMPLEX
Deposited on 2004-07-12, released 2004-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF0537
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3D2 (1-770)
      • cloning artifact (0)
      • engineered (4)
    Domains in SCOPe 2.01: d1u04a1, d1u04a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u04A (A:)
    smkaivvinlvkinkkiipdkiyvyrlfndpeeelqkegysiyrlayenvgividpenli
    iattkeleyegefipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktf
    gdykvipsvemsvikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlml
    kdiasplktvykpcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvd
    lkqpailakfaskikknknykiyllpqlvvptynaeqlesdvakeileytklmpeerkel
    lenilaevdsdiidkslseievekiaqelenkirvrddkgnsvpisqlnvqksqlllwtn
    ysrkypvilpyevpekfrkireipmfiildsglladiqnfatnefrelvksmyyslakky
    nslakkarstneiglpfldfrgkekvitedlnsdkgiievveqvssfmkgkelglafiaa
    rnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsklg
    vkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvd
    mneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknh
    pvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvld
    ifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u04A (A:)
    smkaivvinlvkinkkiipdkiyvyrlysiyrlayenvgividpenliiattkeleyege
    fipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgdykvipsvems
    vikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkdiasplktvyk
    pcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlkqpailakfas
    knykiyllpqlvvptynaeqlakeileytklmpeerkellenilaevdsdiidkslseie
    vekiaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiil
    dsglladiqnfatnefrelvksmyyekvitedlnsdkgiievveqvssfmkgkelglafi
    aarnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsk
    lgvkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrges
    vdmneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdvik
    nhpvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdv
    ldifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv