PDB entry 1u04

View 1u04 on RCSB PDB site
Description: Crystal structure of full length Argonaute from Pyrococcus furiosus
Class: hydrolase/gene regulation
Keywords: RNAi, Silencing, Argonaute, PIWI, PAZ, RISC, Slicer, RNase H
Deposited on 2004-07-12, released 2004-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2004-09-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.227
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF0537
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3D2 (1-770)
      • cloning artifact (0)
      • modified residue (1)
      • engineered (4)
      • modified residue (130)
      • modified residue (152)
      • modified residue (171)
      • modified residue (178)
      • modified residue (292)
      • modified residue (384)
      • modified residue (411)
      • modified residue (467)
      • modified residue (562)
      • modified residue (575)
      • modified residue (600)
      • modified residue (607)
      • modified residue (645)
      • modified residue (653)
      • modified residue (667)
      • modified residue (669)
      • modified residue (735)
    Domains in SCOP 1.73: d1u04a1, d1u04a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u04A (A:)
    smkaivvinlvkinkkiipdkiyvyrlfndpeeelqkegysiyrlayenvgividpenli
    iattkeleyegefipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktf
    gdykvipsvemsvikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlml
    kdiasplktvykpcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvd
    lkqpailakfaskikknknykiyllpqlvvptynaeqlesdvakeileytklmpeerkel
    lenilaevdsdiidkslseievekiaqelenkirvrddkgnsvpisqlnvqksqlllwtn
    ysrkypvilpyevpekfrkireipmfiildsglladiqnfatnefrelvksmyyslakky
    nslakkarstneiglpfldfrgkekvitedlnsdkgiievveqvssfmkgkelglafiaa
    rnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsklg
    vkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrgesvd
    mneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdviknh
    pvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdvld
    ifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u04A (A:)
    smkaivvinlvkinkkiipdkiyvyrlysiyrlayenvgividpenliiattkeleyege
    fipegeisfselrndyqsklvlrllkengigeyelskllrkfrkpktfgdykvipsvems
    vikhdedfylvihiihqiqsmktlwelvnkdpkeleeflmthkenlmlkdiasplktvyk
    pcfeeytkkpkldhnqeivkywynyhierywntpeaklefyrkfgqvdlkqpailakfas
    knykiyllpqlvvptynaeqlakeileytklmpeerkellenilaevdsdiidkslseie
    vekiaqelenkirvrddkgnsvpisqllwtnysrkypvilpyevpekfrkireipmfiil
    dsglladiqnfatnefrelvksmyyekvitedlnsdkgiievveqvssfmkgkelglafi
    aarnklssekfeeikrrlfnlnvisqvvnedtlknkrdkydrnrldlfvrhnllfqvlsk
    lgvkyyvldyrfnydyiigidvapmkrsegyiggsavmfdsqgyirkivpikigeqrges
    vdmneffkemvdkfkefnikldnkkilllrdgritnneeeglkyisemfdievvtmdvik
    nhpvrafanmkmyfnlggaiyliphklkqakgtpipiklakkriikngkvekqsitrqdv
    ldifiltrlnygsisadmrlpapvhyahkfanairnewkikeeflaegflyfv