PDB entry 1u02

View 1u02 on RCSB PDB site
Description: crystal structure of trehalose-6-phosphate phosphatase related protein
Deposited on 2004-07-12, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u02a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u02A (A:)
    mslifldydgtlvpiimnpeesyadagllslisdlkerfdtyivtgrspeeisrflpldi
    nmicyhgacskingqivynngsdrflgvfdriyedtrswvsdfpglriyrknlavlyhlg
    lmgadmkpklrsrieeiarifgvetyygkmiielrvpgvnkgsairsvrgerpaiiagdd
    atdeaafeanddaltikvgegethakfhvadyiemrkilkfiemlgvqkkqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u02A (A:)
    slifldydgtlvpiimnpeesyadagllslisdlkerfdtyivtgrspeeisrflpldin
    micyhgacskingqivynngsdrflgvfdriyedtrswvsdfpglriyrknlavlyhlgl
    mgadmkpklrsrieeiarifgvetyygkmiielrvpgvnkgsairsvrgerpaiiagdda
    tdeaafeanddaltikvgegethakfhvadyiemrkilkfiemlgvqkk