PDB entry 1tzz

View 1tzz on RCSB PDB site
Description: Crystal structure of the protein L1841, unknown member of enolase superfamily from Bradyrhizobium japonicum
Class: structural genomics, unknown function
Keywords: Structural Genomics, protein L1841, mandelate racemase like fold, NYSGXRC target T1523, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium
Deposited on 2004-07-12, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.234
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein L1841
    Species: Bradyrhizobium japonicum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tzza1, d1tzza2
  • Chain 'B':
    Compound: Hypothetical protein L1841
    Species: Bradyrhizobium japonicum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1tzzb1, d1tzzb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzzA (A:)
    gshmsvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngr
    ygqgglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtid
    mavwdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrg
    ynvvkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfw
    yeevgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsy
    glceyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgv
    rvenghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzzA (A:)
    vrivdvreitkpisstkmttslvavvtdvvregkrvvgygfnsngrygqgglirerfasr
    ileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagkp
    lfrllaerhgvkanprvfvyaaggyyglsmlrgemrgyldrgynvvkmkiggapieedrm
    rieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalqaalae
    fypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlkthgws
    psrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlpgigfe
    gksdlykemkalae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzzB (B:)
    gshmsvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngr
    ygqgglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtid
    mavwdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrg
    ynvvkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfw
    yeevgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsy
    glceyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgv
    rvenghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzzB (B:)
    svrivdvreitkpisstkmttslvavvtdvvregkrvvgygfnsngrygqgglirerfas
    rileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagk
    plfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvvkmkiggapi
    eedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeevgdpldyalq
    aalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglceyqrtlevlk
    thgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrvenghitmpdlp
    gigfegksdlykemkalae