PDB entry 1tzw

View 1tzw on RCSB PDB site
Description: T. maritima NusB, P3121, Form 2
Class: transcription
Keywords: N-utilization substance, NusB, RNA-protein interaction, transcriptional antitermination, transcription regulation
Deposited on 2004-07-12, released 2004-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: N utilization substance protein B homolog
  Species: Thermotoga maritima [TaxId:2336]
  Gene: nusb, TM1765
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X286 (0-141)
  Domains in SCOPe 2.08: d1tzwa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tzwA (A:)
  mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
  iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
  kfvngildriakehapkekfel