PDB entry 1tzu

View 1tzu on RCSB PDB site
Description: T. maritima NusB, P212121
Class: transcription
Keywords: N-utilization substance, NusB, RNA-protein interaction, transcriptional antitermination, transcription regulation, TRANSCRIPTION
Deposited on 2004-07-12, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.226
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N utilization substance protein B homolog
    Species: Thermotoga maritima [TaxId:2336]
    Gene: nusb, TM1765
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzuA (A:)
    mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
    iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
    kfvngildriakehapkekfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzuA (A:)
    ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
    ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
    fvngildriakehapkekfel