PDB entry 1tzt

View 1tzt on RCSB PDB site
Description: T. maritima NusB, P21
Deposited on 2004-07-12, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.236
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tzta_
  • Chain 'B':
    Domains in SCOP 1.69: d1tztb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tztA (A:)
    mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
    iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
    kfvngildriakehapkekfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tztA (A:)
    ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
    ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
    fvngildriakehapkekfel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tztB (B:)
    mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsm
    iddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensg
    kfvngildriakehapkekfel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tztB (B:)
    ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
    ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
    fvngildriakehapkekfel