PDB entry 1tzs

View 1tzs on RCSB PDB site
Description: Crystal Structure of an activation intermediate of Cathepsin E
Class: Hydrolase
Keywords: Hydrolase, aspartic protease, activation intermediate
Deposited on 2004-07-12, released 2005-07-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin E
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1tzsa_
  • Chain 'P':
    Compound: activation peptide from Cathepsin E
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 23-mer peptide from PelB-IgG kappa light chain fusion protein
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAD53876 (Start-21)
      • cloning artifact (22)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzsA (A:)
    iqftescsmdqsakeplinyldmeyfgtisigsppqnftvifdtgssnlwvpsvyctspa
    ckthsrfqpsqsstysqpgqsfsiqygtgslsgiigadqvsvegltvvgqqfgesvtepg
    qtfvdaefdgilglgypslavggvtpvfdnmmaqnlvdlpmfsvymssnpeggagselif
    ggydhshfsgslnwvpvtkqaywqialdniqvggtvmfcsegcqaivdtgtslitgpsdk
    ikqlqnaigaapvdgeyavecanlnvmpdvtftingvpytlsptaytlldfvdgmqfcss
    gfqgldihppagplwilgdvfirqfysvfdrgnnrvglapavpwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzsA (A:)
    keplinyldmeyfgtisigsppqnftvifdtgssnlwvpsvyctspackthsrfqpsqss
    tysqpgqsfsiqygtgslsgiigadqvsvegltvvgqqfgesvtepgqtfvdaefdgilg
    lgypslavggvtpvfdnmmaqnlvdlpmfsvymssnpgagselifggydhshfsgslnwv
    pvtkqaywqialdniqvggtvmfcsegcqaivdtgtslitgpsdkikqlqnaigaapvdg
    eyavecanlnvmpdvtftingvpytlsptaytlldqfcssgfqgldihppagplwilgdv
    firqfysvfdrgnnrvglapav
    

  • Chain 'P':
    No sequence available.

  • Chain 'X':
    No sequence available.