PDB entry 1tzq

View 1tzq on RCSB PDB site
Description: Crystal structure of the equinatoxin II 8-69 double cysteine mutant
Class: toxin
Keywords: beta-sandwich, TOXIN
Deposited on 2004-07-11, released 2004-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: equinatoxin II
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61914 (0-174)
      • engineered (3)
      • engineered (64)
    Domains in SCOPe 2.05: d1tzqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tzqA (A:)
agacidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk
vphgcallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg
krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska