PDB entry 1tzp

View 1tzp on RCSB PDB site
Description: MEPA, inactive form without ZN in P21
Class: Hydrolase
Keywords: LAS enzyme, metallopeptidase, peptidoglycan hydrolase
Deposited on 2004-07-11, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.184
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzpa_
  • Chain 'B':
    Compound: Penicillin-insensitive murein endopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: mepA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzpb_
  • Heterogens: SO4, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzpA (A:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzpA (A:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeplppscqalldehvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzpB (B:)
    atpwqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiq
    rlssqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpq
    aldlvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrk
    vrpwfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfeppkpgttkpekktpp
    plppscqalldehvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzpB (B:)
    wqkitqpvpgsaqsigsfsngcivgadtlpiqsehyqvmrtdqrryfghpdlvmfiqrls
    sqvsnlgmgtvligdmgmpaggrfngghashqtgldvdiflqlpktrwtsaqllrpqald
    lvsrdgkhvvstlwkpeifsliklaaqdkdvtrifvnpaikqqlcldagtdrdwlrkvrp
    wfqhrahmhvrlrcpadslecedqplppsgdgcgaelqswfepplppscqalldeh