PDB entry 1tzo

View 1tzo on RCSB PDB site
Description: Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore
Class: toxin
Keywords: heptamer, TOXIN
Deposited on 2004-07-10, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.314
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoa1, d1tzoa2
  • Chain 'B':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzob1, d1tzob2
  • Chain 'C':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoc1, d1tzoc2
  • Chain 'D':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzod1, d1tzod2
  • Chain 'E':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoe1, d1tzoe2
  • Chain 'F':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzof1, d1tzof2
  • Chain 'G':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzog1, d1tzog2
  • Chain 'H':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoh1, d1tzoh2
  • Chain 'I':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoi1, d1tzoi2
  • Chain 'J':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoj1, d1tzoj2
  • Chain 'K':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzok1, d1tzok2
  • Chain 'L':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzol1, d1tzol2
  • Chain 'M':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzom1, d1tzom2
  • Chain 'O':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:191218]
    Gene: pagA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tzoo1, d1tzoo2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzoA (A:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoA (A:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzoB (B:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoB (B:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tzoC (C:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoC (C:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tzoD (D:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoD (D:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tzoE (E:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoE (E:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tzoF (F:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoF (F:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tzoG (G:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoG (G:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tzoH (H:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoH (H:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tzoI (I:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoI (I:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1tzoJ (J:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoJ (J:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1tzoK (K:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoK (K:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1tzoL (L:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoL (L:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1tzoM (M:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoM (M:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1tzoO (O:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtisknt
    stsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmgln
    tadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyyps
    knlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdt
    gsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgf
    nepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilird
    krfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglk
    evindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsen
    gdtstngikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzoO (O:)
    tvpdrdndgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpy
    sdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqdsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlp
    qiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqy
    qgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnn
    iavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindrydm
    lnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngik
    kilifskkgyeig