PDB entry 1tzl

View 1tzl on RCSB PDB site
Description: Crystal Structure of Pyranose 2-Oxidase from the White-Rot Fungus Peniophora sp.
Class: oxidoreductase
Keywords: GMC oxidoreductase, glucose-methanol-choline family, large inner cavity
Deposited on 2004-07-10, released 2004-10-19
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.176
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzla1, d1tzla2
  • Chain 'B':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzlb1, d1tzlb2
  • Chain 'C':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzlc1, d1tzlc2
  • Chain 'D':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzld1, d1tzld2
  • Chain 'E':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzle1, d1tzle2
  • Chain 'F':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzlf1, d1tzlf2
  • Chain 'G':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzlg1, d1tzlg2
  • Chain 'H':
    Compound: Pyranose oxidase
    Species: Peniophora sp. SG
    Gene: p2ox
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8J136
      • modified residue (41)
      • modified residue (72)
      • modified residue (110)
      • modified residue (162)
      • modified residue (366)
      • modified residue (378)
      • modified residue (414-415)
      • modified residue (495)
      • modified residue (516-517)
      • modified residue (520)
      • modified residue (523)
      • modified residue (539)
      • modified residue (553)
      • modified residue (597)
    Domains in SCOP 1.73: d1tzlh1, d1tzlh2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzlA (A:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlA (A:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzlB (B:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlB (B:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tzlC (C:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlC (C:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tzlD (D:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlD (D:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tzlE (E:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlE (E:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tzlF (F:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlF (F:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tzlG (G:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlG (G:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tzlH (H:)
    stsssdpffnfakssfrsaaaqkasasslpplpgpdkkvpgmdikydvvivgsgpigcty
    arelvgagykvamfdigeidsglkigahkkntveyqknidkfvnviqgqlmsvsvpvntl
    vvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvggmsthwtcatprfdreqrp
    llvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlvlnklaeeykgqrdfqqipl
    aatrrsptfvewssantvfdlqnrpntdapeerfnlfpavacervvrnalnseieslhih
    dlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnptnppellpslgsyiteqsl
    vfcqtvmstelidsvksdmtirgtpgeltysvtytpgastnkhpdwwnekvknhmmqhqe
    dplpipfedpepqvttlfqpshpwhtqihrdafsygavqqsidsrlivdwrffgrtepke
    enklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfm
    epglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamsl
    aiksceyikqnftpspftseaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzlH (H:)
    mdikydvvivgsgpigctyarelvgagykvamfdigeidsglkigahkkntveyqknidk
    fvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvg
    gmsthwtcatprfdreqrpllvkddadaddaewdrlytkaesyfqtgtdqfkesirhnlv
    lnklaeeykgqrdfqqiplaatrrsptfvewssantvfdlqnrpntdapeerfnlfpava
    cervvrnalnseieslhihdlisgdrfeikadvyvltagavhntqllvnsgfgqlgrpnp
    tnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytpgastn
    khpdwwnekvknhmmqhqedplpipfedpepqvttlfqpshpwhtqihrdafsygavqqs
    idsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdm
    cvmsakiggflpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflgg
    cgniptayganptltamslaiksceyikqnftpspft