PDB entry 1tzg

View 1tzg on RCSB PDB site
Description: Crystal structure of HIV-1 neutralizing human Fab 4E10 in complex with a 13-residue peptide containing the 4E10 epitope on gp41
Class: immune system
Keywords: antibody-epitope complex, IMMUNE SYSTEM
Deposited on 2004-07-09, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZG (0-231)
    Domains in SCOPe 2.07: d1tzgh1, d1tzgh2
  • Chain 'I':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZG (0-End)
    Domains in SCOPe 2.07: d1tzgi1, d1tzgi2
  • Chain 'L':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZG (0-213)
    Domains in SCOPe 2.07: d1tzgl1, d1tzgl2
  • Chain 'M':
    Compound: Fab 4E10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZG (0-213)
    Domains in SCOPe 2.07: d1tzgm1, d1tzgm2
  • Chain 'P':
    Compound: Envelope polyprotein GP160
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZG (Start-12)
  • Chain 'Q':
    Compound: Envelope polyprotein GP160
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZG (Start-12)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tzgH (H:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1tzgI (I:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzgI (I:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tzgL (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tzgM (M:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.