PDB entry 1tzf

View 1tzf on RCSB PDB site
Description: X-ray Crystal Structure of alpha-D-glucose-1-phosphate cytidylyltransferase from Salmonella typhi
Class: transferase
Keywords: nucleotidyltransferase; mixed alpha/beta fold, TRANSFERASE
Deposited on 2004-07-09, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-1-phosphate cytidylyltransferase
    Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:220341]
    Gene: rfbF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26396 (3-258)
      • cloning artifact (0-2)
      • conflict (168)
    Domains in SCOPe 2.07: d1tzfa1, d1tzfa2
  • Heterogens: MG, C5G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzfA (A:)
    maskavilagglgtrlseetivkpkpmveiggkpilwhimkmysvhgikdfiiccgykgy
    vikeyfanyflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvk
    ddeaflftygdgvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekp
    kgdgaminggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrd
    kvyleglwekgkapwktwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzfA (A:)
    maskavilagglgvkpkpmveiggkpilwhimkmysvhgikdfiiccgykgyvikeyfan
    yflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvkddeaflft
    ygdgvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekpkgdgamin
    ggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrdkvyleglw
    ekgkapwktwe