PDB entry 1tze

View 1tze on RCSB PDB site
Description: signal transduction adaptor growth factor, grb2 sh2 domain complexed with phosphotyrosyl heptapeptide lys-pro-phe-ptyr-val-asn-val-nh2 (kfppyvnc-nh2)
Class: complex (signal transduction/peptide)
Keywords: SIGNAL TRANSDUCTION ADAPTOR GROWTH FACTOR BOUND PROTEIN 2 (GRB2) SRC HOMOLOGY 2 DOMAIN (SH2), PHOSPHOTYROSYL HEPTAPEPTIC LIGAND, COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE), COMPLEX (SIGNAL TRANSDUCTION-PEPTIDE) complex
Deposited on 1996-06-06, released 1997-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2 55-152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tzee_
  • Chain 'I':
    Compound: phosphotyrosyl heptapeptide lys-pro-phe-ptyr-val-asn-val-nh2
    Database cross-references and differences (RAF-indexed):
    • PDB 1TZE (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tzeE (E:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie
    

  • Chain 'I':
    No sequence available.