PDB entry 1tza

View 1tza on RCSB PDB site
Description: X-ray structure of Northeast Structural Genomics Consortium target SoR45
Deposited on 2004-07-09, released 2004-07-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tzaa_
  • Chain 'B':
    Domains in SCOP 1.71: d1tzab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tzaA (A:)
    msaldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangkt
    sevqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrla
    tpgllhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzaA (A:)
    aldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangktse
    vqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatp
    gllhlehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tzaB (B:)
    msaldnsirvevkteyieqqsspedekylfsytitiinlgeqaakletrhwiitdangkt
    sevqgagvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrla
    tpgllhlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tzaB (B:)
    aldnsirvevkteyieqqssekylfsytitiinlgeqaakletrhwiitdangktsevqg
    agvvgetptippntayqytsgtvldtpfgimygtygmvsesgehfnaiikpfrlatpgll
    hlehhhhhh