PDB entry 1tz9

View 1tz9 on RCSB PDB site
Description: crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41
Deposited on 2004-07-09, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tz9a_
  • Chain 'B':
    Domains in SCOP 1.69: d1tz9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz9A (A:)
    mghhhhhhshmkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqal
    kqsveqeglallgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpif
    gwaktdlayenedgslsllfdqavvenmqpedmyqlihsqskgfrlpgweeerlqqfqel
    kamyagvteedlvenlryflervipvceeenikmgihpddppweifglpritknladlkr
    ilslvdspangitfctgslgadptndlptmireighrinfvhfrnvkylgehrfeetahp
    svagsldmaelmqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqglyeat
    kakqnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz9A (A:)
    mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqegla
    llgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlaye
    nedgslsllfdqavvenmqpedmyqlihsweeerlqqfqelkamyagvteedlvenlryf
    lervipvceeenikmgihpddppweifglpritknladlkrilslvdspangitfctgsl
    gadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmaelmqalvdvg
    yegvirpdhgraiwdekampgyglydramgltyiqglyeatkak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz9B (B:)
    mghhhhhhshmkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqal
    kqsveqeglallgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpif
    gwaktdlayenedgslsllfdqavvenmqpedmyqlihsqskgfrlpgweeerlqqfqel
    kamyagvteedlvenlryflervipvceeenikmgihpddppweifglpritknladlkr
    ilslvdspangitfctgslgadptndlptmireighrinfvhfrnvkylgehrfeetahp
    svagsldmaelmqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqglyeat
    kakqnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz9B (B:)
    mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqegla
    llgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlaye
    nedgslsllfdqavvenmqpedmyqlihsweeerlqqfqelkamyagvteedlvenlryf
    lervipvceeenikmgihpddppweifglpritknladlkrilslvdspangitfctgsl
    gadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmaelmqalvdvg
    yegvirpdhgraiwdekampgyglydramgltyiqglyeatkak