PDB entry 1tz9

View 1tz9 on RCSB PDB site
Description: Crystal Structure of the Putative Mannonate Dehydratase from Enterococcus faecalis, Northeast Structural Genomics Target EfR41
Class: lyase
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LYASE
Deposited on 2004-07-09, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannonate dehydratase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: uxuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZC9
      • modified residue (10)
      • modified residue (147)
      • modified residue (152)
      • modified residue (182)
      • modified residue (213)
      • modified residue (269)
      • modified residue (307)
      • modified residue (311)
      • modified residue (337)
      • modified residue (347)
    Domains in SCOPe 2.07: d1tz9a1, d1tz9a2
  • Chain 'B':
    Compound: Mannonate dehydratase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: uxuA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZC9
      • modified residue (10)
      • modified residue (147)
      • modified residue (152)
      • modified residue (182)
      • modified residue (213)
      • modified residue (269)
      • modified residue (307)
      • modified residue (311)
      • modified residue (337)
      • modified residue (347)
    Domains in SCOPe 2.07: d1tz9b1, d1tz9b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz9A (A:)
    mghhhhhhshmkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqal
    kqsveqeglallgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpif
    gwaktdlayenedgslsllfdqavvenmqpedmyqlihsqskgfrlpgweeerlqqfqel
    kamyagvteedlvenlryflervipvceeenikmgihpddppweifglpritknladlkr
    ilslvdspangitfctgslgadptndlptmireighrinfvhfrnvkylgehrfeetahp
    svagsldmaelmqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqglyeat
    kakqnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz9A (A:)
    mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqegla
    llgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlaye
    nedgslsllfdqavvenmqpedmyqlihsweeerlqqfqelkamyagvteedlvenlryf
    lervipvceeenikmgihpddppweifglpritknladlkrilslvdspangitfctgsl
    gadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmaelmqalvdvg
    yegvirpdhgraiwdekampgyglydramgltyiqglyeatkak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz9B (B:)
    mghhhhhhshmkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqal
    kqsveqeglallgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpif
    gwaktdlayenedgslsllfdqavvenmqpedmyqlihsqskgfrlpgweeerlqqfqel
    kamyagvteedlvenlryflervipvceeenikmgihpddppweifglpritknladlkr
    ilslvdspangitfctgslgadptndlptmireighrinfvhfrnvkylgehrfeetahp
    svagsldmaelmqalvdvgyegvirpdhgraiwdekampgyglydramgltyiqglyeat
    kakqnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz9B (B:)
    mkwgfrwygaagdaiplkhirqipgitgvvgtllnklpgdvwtvaeiqalkqsveqegla
    llgiesvaihdaikagtdqrdhyidnyrqtlrnlgkcgislvcysfkpifgwaktdlaye
    nedgslsllfdqavvenmqpedmyqlihsweeerlqqfqelkamyagvteedlvenlryf
    lervipvceeenikmgihpddppweifglpritknladlkrilslvdspangitfctgsl
    gadptndlptmireighrinfvhfrnvkylgehrfeetahpsvagsldmaelmqalvdvg
    yegvirpdhgraiwdekampgyglydramgltyiqglyeatkak