PDB entry 1tz7

View 1tz7 on RCSB PDB site
Description: Aquifex aeolicus amylomaltase
Class: transferase
Keywords: (beta, alpha)8- barrel, TRANSFERASE
Deposited on 2004-07-09, released 2005-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66937 (20-504)
      • expression tag (17-19)
      • conflict (293)
    Domains in SCOPe 2.08: d1tz7a1, d1tz7a2
  • Chain 'B':
    Compound: 4-alpha-glucanotransferase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66937 (20-504)
      • expression tag (18-19)
      • conflict (293)
    Domains in SCOPe 2.08: d1tz7b2, d1tz7b3
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz7A (A:)
    mgsshhhhhhssglvprgshmrlagillhvtslpspygigdlgkeayrfldflkecgfsl
    wqvlplnptsleagnspyssnslfagnyvlidpeelleedlikerdlkrfplgealyevv
    yeykkellekafknfrrfelledflkehsywlrdyalymaikeeegkewyewdeelkrre
    kealkrvlnklkgrfyfhvfvqfvffkqweklrryarergisivgdlpmypsyssadvwt
    npelfkldgdlkplfvagvppdffsktgqlwgnpvynweehekegfrwwirrvlhnlklf
    dflrldhfrgfeaywevpygeetavngrwvkapgktlfkkllsyfpknpfiaedlgfitd
    evrylretfkipgsrviefafydkesehlphnveennvyytsthdlppirgwfenlgees
    rkrlfeylgreikeekvneelirlvlisrakfaiiqmqdllnlgnearmnypgrpfgnwr
    wrikedytqkkefikkllgiygrev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz7A (A:)
    gshmrlagillhvtslpspygigdlgkeayrfldflkecgfslwqvlplnptsleagnsp
    yssnslfagnyvlidpeelleedlikerdlkrfplgealyevvyeykkellekafknfrr
    felledflkehsywlrdyalymaikeeegkewyewdeelkrrekealkrvlnklkgrfyf
    hvfvqfvffkqweklrryarergisivgdlpmypsyssadvwtnpelfkldgdlkplfva
    gvppdffsktgqlwgnpvynweehekegfrwwirrvlhnlklfdflrldhfrgfeaywev
    pygeetavngrwvkapgktlfkkllsyfpknpfiaedlgfitdevrylretfkipgsrvi
    efafydkesehlphnveennvyytsthdlppirgwfenlgeesrkrlfeylgreikeekv
    neelirlvlisrakfaiiqmqdllnlgnearmnypgrpfgnwrwrikedytqkkefikkl
    lgiygrev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz7B (B:)
    mgsshhhhhhssglvprgshmrlagillhvtslpspygigdlgkeayrfldflkecgfsl
    wqvlplnptsleagnspyssnslfagnyvlidpeelleedlikerdlkrfplgealyevv
    yeykkellekafknfrrfelledflkehsywlrdyalymaikeeegkewyewdeelkrre
    kealkrvlnklkgrfyfhvfvqfvffkqweklrryarergisivgdlpmypsyssadvwt
    npelfkldgdlkplfvagvppdffsktgqlwgnpvynweehekegfrwwirrvlhnlklf
    dflrldhfrgfeaywevpygeetavngrwvkapgktlfkkllsyfpknpfiaedlgfitd
    evrylretfkipgsrviefafydkesehlphnveennvyytsthdlppirgwfenlgees
    rkrlfeylgreikeekvneelirlvlisrakfaiiqmqdllnlgnearmnypgrpfgnwr
    wrikedytqkkefikkllgiygrev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz7B (B:)
    shmrlagillhvtslpspygigdlgkeayrfldflkecgfslwqvlplnptsleagnspy
    ssnslfagnyvlidpeelleedlikerdlkrfplgealyevvyeykkellekafknfrrf
    elledflkehsywlrdyalymaikeeegkewyewdeelkrrekealkrvlnklkgrfyfh
    vfvqfvffkqweklrryarergisivgdlpmypsyssadvwtnpelfkldgdlkplfvag
    vppdffsktgqlwgnpvynweehekegfrwwirrvlhnlklfdflrldhfrgfeaywevp
    ygeetavngrwvkapgktlfkkllsyfpknpfiaedlgfitdevrylretfkipgsrvie
    fafydkesehlphnveennvyytsthdlppirgwfenlgeesrkrlfeylgreikeekvn
    eelirlvlisrakfaiiqmqdllnlgnearmnypgrpfgnwrwrikedytqkkefikkll
    giygrev