PDB entry 1tz5

View 1tz5 on RCSB PDB site
Description: [pNPY19-23]-hPP bound to DPC Micelles
Class: hormone/growth factor
Keywords: NPY-PP Chimera, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2004-07-09, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera of Pancreatic hormone and Neuropeptide Y
    Species: Homo sapiens, Sus scrofa [TaxId:9606,9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tz5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tz5A (A:)
    aplepvypgdnatpeqmaryysalrryinmltrpry