PDB entry 1tz3

View 1tz3 on RCSB PDB site
Description: crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside
Class: transferase
Keywords: ribokinase fold, alpha/beta, TRANSFERASE
Deposited on 2004-07-09, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative sugar kinase
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: stm4066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKR2
      • modified residue (167)
      • modified residue (184)
      • modified residue (305)
      • modified residue (313)
    Domains in SCOPe 2.07: d1tz3a_
  • Chain 'B':
    Compound: putative sugar kinase
    Species: Salmonella typhimurium [TaxId:99287]
    Gene: stm4066
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZKR2
      • modified residue (167)
      • modified residue (184)
      • modified residue (305)
      • modified residue (313)
    Domains in SCOPe 2.07: d1tz3b_
  • Heterogens: K, AIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz3A (A:)
    mgsshhhhhhssglvprgshmkamnkvwvigdasvdlvpekqnsylkcpggasanvgvcv
    arlggecgfigclgdddagrflrqvfqdngvdvtflrldadltsavlivnltadgersft
    ylvhpgadtyvspqdlppfrqyewfyfssigltdrpareaclegarrmreaggyvlfdvn
    lrskmwgntdeipeliarsaalasickvsadelcqlsgashwqdaryylrdlgcdttiis
    lgadgallitaegefhfpaprvdvvdttgagdafvggllftlsrancwdhallaeaisna
    nacgamavtakgamtalpfpdqlntflsshslaqamtvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz3A (A:)
    nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq
    vfqdngvdvtflrldadltsavlivnsftylvhpgadtyvspqdlppfrqyewfyfssig
    ltdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalasickvsad
    elcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdvvdttgag
    dafvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqlntflssh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz3B (B:)
    mgsshhhhhhssglvprgshmkamnkvwvigdasvdlvpekqnsylkcpggasanvgvcv
    arlggecgfigclgdddagrflrqvfqdngvdvtflrldadltsavlivnltadgersft
    ylvhpgadtyvspqdlppfrqyewfyfssigltdrpareaclegarrmreaggyvlfdvn
    lrskmwgntdeipeliarsaalasickvsadelcqlsgashwqdaryylrdlgcdttiis
    lgadgallitaegefhfpaprvdvvdttgagdafvggllftlsrancwdhallaeaisna
    nacgamavtakgamtalpfpdqlntflsshslaqamtvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz3B (B:)
    nkvwvigdasvdlvpekqnsylkcpggasanvgvcvarlggecgfigclgdddagrflrq
    vfqdngvdvtflrldadltsavlivnftylvhpgadtyvspqdlppfrqyewfyfssigl
    tdrpareaclegarrmreaggyvlfdvnlrskmwgntdeipeliarsaalasickvsade
    lcqlsgashwqdaryylrdlgcdttiislgadgallitaegefhfpaprvdvvdttgagd
    afvggllftlsrancwdhallaeaisnanacgamavtakgamtalpfpdqlntflssh