PDB entry 1tz2

View 1tz2 on RCSB PDB site
Description: Crystal structure of 1-aminocyclopropane-1-carboyxlate deaminase complexed with ACC
Deposited on 2004-07-09, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tz2a_
  • Chain 'B':
    Domains in SCOP 1.71: d1tz2b_
  • Chain 'C':
    Domains in SCOP 1.71: d1tz2c_
  • Chain 'D':
    Domains in SCOP 1.71: d1tz2d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz2A (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz2A (A:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelg
    fkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvg
    lerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvr
    ngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz2B (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz2B (B:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfkf
    dyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgler
    dimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrnge
    fpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tz2C (C:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tz2D (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvpdgfdigfrrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevr
    aqeaelgfkfdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriar
    qtaekvglerdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmh
    gmiemvrngefpegsrvlyahlggvpalngysfifrdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz2D (D:)
    mnlqrfprypltfgptpiqplarlskhlggkvhlyakredcnsglafggnktrkleylip
    ealaqgcdtlvsiggiqsnqtrqvaavaahlgmkcvlvqenwvnysdavydrvgniqmsr
    ilgadvrlvrswedalesvraaggkpyaipagcsdhplgglgfvgfaeevraqeaelgfk
    fdyvvvcsvtgstqagmvvgfaadgradrvigvdasakpaqtreqitriarqtaekvgle
    rdimradvvlderfagpeyglpnegtleairlcartegmltdpvyegksmhgmiemvrng
    efpegsrvlyahlggvpalngysfifrdg