PDB entry 1tz0

View 1tz0 on RCSB PDB site
Description: Crystal Structure of Putative Antibiotic Biosythesis Monooxygenase from Bacillus cereus
Deposited on 2004-07-09, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.21
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tz0a_
  • Chain 'B':
    Domains in SCOP 1.69: d1tz0b_
  • Chain 'C':
    Domains in SCOP 1.69: d1tz0c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tz0A (A:)
    snamgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvm
    irweseeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz0A (A:)
    gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
    seeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tz0B (B:)
    snamgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvm
    irweseeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz0B (B:)
    gymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwe
    seeawknwetseehlagpdhiinvdhavyyvksskaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tz0C (C:)
    snamgymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvm
    irweseeawknwetseehlaghragrgkpkpdhiinvdhavyyvksskaayqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tz0C (C:)
    ymfietktftvkegtsnivverftgegiiekfegfidlsvlvkkvrrgdeevvvmirwes
    eeawknwetseehlgkpkpdhiinvdhavyyvksskaayqq