PDB entry 1tyv

View 1tyv on RCSB PDB site
Description: structure of tailspike-protein
Class: viral adhesion protein
Keywords: complex, viral adhesion protein, receptor, endoglycosidase carbohydrate, cell receptor, recognition, binding protein lipopolysaccharide
Deposited on 1996-07-26, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tailspike protein
    Species: Enterobacteria phage P22 [TaxId:10754]
    Gene: PHAGE P22 GENE 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tyva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tyvA (A:)
    ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
    figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
    qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
    vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsvssaqflrnnggferdggvigf
    tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeldrpgdy
    pitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvf
    tniaiidtntkdfqanqiyisgacrvnglrligirstdgqgltidapnstvsgitgmvdp
    srinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytq
    ltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvk
    kpngelvrltlatl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tyvA (A:)
    ysieadkkfkysvklsdyptlqdaasaavdgllidrdynfyggetvdfggkvltieckak
    figdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqsktdgy
    qptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgchfckm
    vdannpsggkdgiitfenlsgdwgkgnyviggrtsygsvssaqflrnnggferdggvigf
    tsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtrpgdypitqypl
    hqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllthesvftniaiid
    tntkdfqanqiyisgacrvnglrligirsltidapnstvsgitgmvdpsrinvanlaeeg
    lgniransfgydsaaiklrihklsktldsgalyshinggagsgsaytqltaisgstpdav
    slkvnhkdcrgaeipfvpdiasddfikdsscflpywennstslkalvkkpngelvrltla
    tl