PDB entry 1tyt

View 1tyt on RCSB PDB site
Description: crystal and molecular structure of crithidia fasciculata trypanothione reductase at 2.6 angstroms resolution
Deposited on 1993-06-10, released 1994-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.161
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tytA (A:)
    msraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpk
    klmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadtegl
    tfhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsne
    afyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlte
    qlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkag
    vevakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdht
    kvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnha
    dgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqk
    gkrveki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tytB (B:)
    sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
    lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
    fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsnea
    fyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlteq
    lranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqldkagv
    evakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdhtk
    vacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnhad
    gevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfyqkg
    krveki